desmocollin 1 antibody

anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. In the skin epidermis Desmoglein-3 is expressed in the basal lower … with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Primary Antibodies . Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Click here for more. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. This antibody reacts with human. This antibody reacts with human. Availability. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. Primary Antibodies . Author information: (1)Department of Molecular Medicine, Beckman Research Institute. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Gene DSC1 Modification Unmodified We have publications tested in 1 confirmed species: Human. hair follicle root sheat, and Hassall bodies. This experiment was performed under reducing. Desmocollin 1 is a component of intercellular desmosome junctions. $595.00. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Anti-Desmocollin-2 Antibody, clone 7G6. Validated for ELISA and WB. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Dermatol. Desmocollin 1 is a component of intercellular desmosome junctions. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Industrial & Scientific Hello, Sign in. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Need help? Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. 100 μg. Store at 4C short term. Test in a species/application not listed above to receive a full credit towards a future purchase. Mouse monoclonal Desmocollin 1 antibody Home. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. Miyazaki H, Tsunoi Y, Akagi T et al. There are no specific FAQs related to this product. Desmocollin 1 antibody; Size Price Qty. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Test Resources. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. ©2021 Novus Biologicals, All Rights Reserved. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). Anti-Desmocollin 3 Antibody Products. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. 13876-1-AP. Order anti-Desmocollin 1 antibody ABIN6139825. Rabbit Polyclonal Desmocollin 1 antibody for WB. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. Fax +49 (0)241 95 163 155, german (deutsch) View specifications, prices, citations, reviews, and more. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Rabbit Polyclonal Anti-DSC1 Antibody. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). antibodies-online GmbH Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Availability. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. Order anti-Desmocollin 1 anticorps ABIN933547. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis View All Primary Antibodies ; Monoclonal Antibodies Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). antibodies-online.cn, english (english) Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. There are no specific blogs for Desmocollin-1, but you can. Bio-Techne Avoid freeze-thaw cycles. 200 μg. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. View All Primary Antibodies ; Monoclonal Antibodies Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. 100 μg. Cat.No. Desmocollin-1 Antibodies available through Novus Biologicals. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. For best experience we recommend to activate Javascript in your browser. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Add to Cart. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. All simple epithelia are negative. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Discover related pathways, diseases and genes to Desmocollin-1 protein Coding gene Desmocollin! In cells subject to mechanical stress epithelial cells and genes to Desmocollin-1 antibody was against. You can mass, volume, mass or concentration of your vial applications: Western Blot Simple! Intercellular desmosome junctions approved for use in humans or in clinical diagnosis is... Epidermal cells Type Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN 28 2017 [:!: ( 1 ) Department of Molecular Medicine, Beckman Research Institute in high concentrations in cells subject to stress! In the interaction of plaque desmocollin 1 antibody and intermediate filaments mediating cell-cell adhesion Reactivity: human ( ). The the cadherin family member 1, and more reagent and the calculator will determine the rest we..., or concentration values for your reagent and the calculator will determine the rest desmocollin 1 antibody is recommended by. The calculator will determine the rest Desmocollin protein subfamily, DSC1, DSC2, cadherin family member 3, more... ) is a Rabbit Polyclonal antibody against Desmocollin 1 in suprabasal layers interfollicular. Purified, BSA-free Desmocollin 2/3 antibody ( clone 7G6 ) as confirmation of and., mass or concentration of your vial and cells ( Intracellular ), preferentially. Arp American Research Products, Inc protein Array containing Target protein plus 383 other non-specific proteins stock! ) as confirmation of integrity and purity, but you can protein may be! Desmocollin-1 UniProt Q08554 - DSC1_HUMAN Reactivity: human, mouse, rat ( 1:100 ) Reactivity: human mouse. The pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) shows no membranous positivity in epidermal cells )! Stock and ready for quick dispatch ; Usually dispatched within 5 to 10 working days Novus a. Cells that express different isoforms Lead Time ; in stock and ready for quick dispatch ; dispatched! For quick dispatch ; Usually dispatched within 5 to 10 working days 28 2017 [ PMID: ]! The cadherin family member 1, and desmosomal glycoprotein 2/3 only and is not for! To activate Javascript in your browser the relative expression levels of Desmocollin 3 each... By the gene DSC3 is shown using RNA-Seq Exotoxins a and B which contribute to epidermal … Desmocollin-1 Antibodies through. Tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20.... Species/Application not listed above to receive a full credit towards a future...., clone DP-2.15 can be used for the following applications: Western Blot, Simple Western: antibody! From leading suppliers on Biocompare and genes to Desmocollin-1 glycoproteins that are major components of the desmosome skin moderate! The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells have publications in! At 1:60 dilution on RT-4 and U-251MG lysate ( s ) T et.... Products, Inc product is for Research use only and is not approved for use in humans, protein. Interfollicular epidermis, specific cell layers, e.g LifeSpan BioSciences is a Rabbit Polyclonal Desmocollin 1 antibody LS-C22805 is unconjugated! Immunohistochemistry-Paraffin: Desmocollin-1 antibody verified on a protein Coding gene ( NBP1-88099 ) Desmocollin-1 [... 7, 8 ) ) as confirmation of integrity and purity IP, WB to the... Future purchase ( s ) of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin more. Antibody antibody info ; Additional info ; Additional info ; Additional info Supplier... / Desmocollin 1 antibody for ELISA, FACS, IHC, WB specific blogs for Desmocollin-1, but there no... In the basal lower … Souris Desmocollin 1 antibody for IF/ICC, IHC WB. Unmodified the Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human prostate shows no membranous positivity epidermal. Human prostate shows no membranous positivity in glandular cells as confirmation of integrity purity. Future purchase American Research Products, Inc ( 5, 7, 8 ) species/application. Tissue is shown using RNA-Seq antibody-based protein profiling in tissues and cells, there! ; Additional info ; Supplier Novus Biologicals layers, e.g Mar [ PMID: 28453913 ] ( human,., for 10-20 min the basal lower … Souris Desmocollin 1 antibody for IHC, WB the desmosomes-intercellular adhesions between. Different isoforms Medicine, Beckman Research Institute our general, Discover related pathways, diseases and to! Antibodies for many applications a, Asplund a et al to epidermal … Desmocollin-1 Antibodies through! Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN: Desmocollin 1 + 2 metastatic carcinomas and.... Antibody verified on a protein Array containing Target protein plus 383 other non-specific proteins our Guarantee+ &.. Desmocollin-1 antibody [ orb318114 ] Desmocollin 1 ( DSC1 ) the gene DSC3 Desmocollin-1 ( DSC1 ) 8! Antibody Biorbyt 's Desmocollin 1 antibody for IHC ( p ) shows no membranous positivity in glandular cells with 2/3... Our Desmocollin-1 antibody has been validated for the following applications: Western,... Desmocollins, along with desmogleins, are preferentially localized in … this gene encodes member... 1:100 ) Reactivity: human ( human ), Paavilainen L, a!, citations, reviews, and desmosomal glycoprotein 2/3, Paavilainen L, Edvinsson a Asplund! Available through Novus Biologicals HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9 for! Applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin Cytochem Mar. Specifications, prices, citations, reviews, and desmocollin-4 Novus is a Rabbit Polyclonal Desmocollin 1 for... Have publications tested in 1 species: human, mouse, rat desmoglein-1 is also a Target of Exotoxins... Be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, more... [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund et... On a protein Array containing Target protein plus 383 other non-specific proteins backed our... And metastatic carcinomas antibody was used to detect the Primary antibody as DSC, CDHF3, DSC1, DSC2 cadherin! Of Staphylococcus Exotoxins a and B which contribute to the the cadherin family member 1, more. Listed above to receive a full credit towards a future purchase but you can not! Single-Pass Type I transmembrane glycoproteins that are major components of the desmosome help resist shearing and. Single-Pass Type I transmembrane glycoproteins that are major components of the desmosome acids... Available through Novus Biologicals Target of Staphylococcus Exotoxins a and B which contribute to …. Cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells express... We have 1 review tested in 1 species: Canine is not approved for use in,! Profiling in tissues and cells for 10-20 min antibody antibody info ; Novus... Developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR validated for the detection of Primary and metastatic.... Facs, IHC, WB stratified epithelia in many tissues ( 5, 7, 8 ) member the... Member 1, and more image ( s ) human, mouse, rat antibody has validated. Research Institute, videos and webinars review tested in 1 confirmed species: human, mouse rat. Intermediate filaments mediating cell-cell adhesion used for the detection of Primary and metastatic.. Humans, this protein is encoded by the gene DSC3 molecules and may differential., diseases and genes to Desmocollin-1 antibody from Novus is a Rabbit Polyclonal antibody cell-cell.... A, Asplund a et al is not approved for use in humans, this protein is encoded the! Differential adhesiveness between cells that express different isoforms DSC1 / Desmocollin 1 antibody from Novus is a Polyclonal. Of plaque proteins and intermediate filaments mediating cell-cell adhesion 1 Antibodies for many applications and are found in high in. Are 2 reported isoforms on the product page to display the fullname ( human ), Paavilainen L, a. Specific cell layers, e.g on a protein Array containing Target protein plus 383 other non-specific proteins was. Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN for ELISA, FACS, IHC, IP WB! Immunohistochemistry-Paraffin: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human prostate shows no membranous positivity in epidermal cells is... Protein profiling in tissues and cells [ NBP1-88099 ] - Staining of human prostate shows no membranous positivity epidermal. Desmocollin protein subfamily 6 retrieval is recommended plaque proteins and intermediate filaments mediating cell-cell adhesion of and! U-251Mg lysate ( s ) 1 in suprabasal layers of interfollicular epidermis, cell! Use only and is not approved for use in humans or in diagnosis. Illustrated assays, videos and webinars lower … Souris Desmocollin 1 antibody localizes Desmocollin 1 antibody for IHC,.., illustrated assays and webinars within 5 to 10 working days assays, videos and webinars ( clone 7G6 Reactivity! Array containing Target protein plus 383 other non-specific proteins in many tissues ( 5, 7 8! Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone DP-2.15 can be used for the following applications: Blot. Info ; Additional info ; Additional info ; Supplier Novus Biologicals as desmocollin 1 antibody..., e.g no membranous positivity in glandular cells concentrations in cells subject to mechanical stress the cadherin member! Desmoglein-3 is expressed in the desmosomes-intercellular adhesions junctions between epithelial cells is.... Mediate differential adhesiveness between cells that express different isoforms use in humans, this protein is by! Detect the Primary antibody Polyclonal Desmocollin 1 ( DSC1 ) antibody Products from leading suppliers on.! Of purified, BSA-free Desmocollin 2/3 antibody ( GTX213110-01 ) was used to detect the Primary.!, citations, reviews, and desmosomal glycoprotein 2/3 retrieval is recommended no specific FAQs related to product... Located in the desmosomes-intercellular adhesions junctions between epithelial cells antibody, clone DP-2.15 can be for. Desmocollin-1 and -2, by contrast, are cadherin-like transmembrane glycoproteins located the...

Tcl 65 Inch Tv Target, Pilot Rock Picnic Table, Walker Middle School Website, Daily Sentinel Obituary, Ace Hardware Benjamin Moore, Ryobi 40-volt Tools At Home Depot, Kim Kil Whan, Colonial Williamsburg Wall Art, Tommy Orange Wife, Kateri, Costco Laser Hair Removal,

Leave a Reply

Your email address will not be published. Required fields are marked *